PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast06G224900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 333aa    MW: 36757.1 Da    PI: 5.6341
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast06G224900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.94.1e-49521773128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         pGfrFhPtdeelv++yL++kv+gk+l++ e+ike+diyk+eP+dLpk  +v +++kewyfF+ r +ky+++ r+nr+t +g+Wkatg d++
  Brast06G224900.1.p  52 PGFRFHPTDEELVTFYLRRKVAGKRLSI-EIIKEMDIYKHEPSDLPKtsTVGGGDKEWYFFCLRGRKYRNSVRPNRVTGAGFWKATGIDRP 141
                         9***************************.89**************95447777999*********************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++  +   vglkk+Lv+y+g+a kg kt+W+mhe+rl
  Brast06G224900.1.p 142 IHG-SAGIVGLKKSLVYYHGSAGKGIKTEWMMHEFRL 177
                         **9.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100551.93350203IPR003441NAC domain
SuperFamilySSF1019414.32E-5451203IPR003441NAC domain
PfamPF023658.3E-2552177IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MVVALKESIM GTMKVMQGDA NHGGSVVLEG GEVVVGEGEV LEGEEEDGVE LPGFRFHPTD  60
EELVTFYLRR KVAGKRLSIE IIKEMDIYKH EPSDLPKTST VGGGDKEWYF FCLRGRKYRN  120
SVRPNRVTGA GFWKATGIDR PIHGSAGIVG LKKSLVYYHG SAGKGIKTEW MMHEFRLPPN  180
TAVNSSPCFQ EAEVWTICRI FKRSVIYKKH PQQQQQQQHI AASQQQQQDS SSGVTGSGSL  240
ESSDCNYEYT MNNNNNNSCM PAPAPVSGYY GGGQQQYFQQ AGMQWSDNGA SAMQQQPAAA  300
LSDGDGCSWD DDIGRMVMEL TDPSVFYDCR YA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-485220917174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561449.21e-166PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLA0A0Q3HDM81e-166A0A0Q3HDM8_BRADI; Uncharacterized protein
STRINGBRADI1G58057.11e-157(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119138129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-74NAC domain containing protein 42